PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G058100.1.p
Common NameLOC101780786, SETIT_025176mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 307aa    MW: 35056.9 Da    PI: 4.7469
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G058100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.99.9e-13139182447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         WT eE+ +++++ +++G g Wk I+r + +++t+ q+ s+ qky
  Seita.3G058100.1.p 139 WTIEEHRQFLCGLREYGRGKWKDISRDFVTTKTPVQVSSHAQKY 182
                         *******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.034131187IPR017930Myb domain
SuperFamilySSF466896.96E-15133188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-9135184IPR009057Homeodomain-like
SMARTSM007172.3E-9135185IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.1E-13136185IPR006447Myb domain, plants
PfamPF002491.2E-9139182IPR001005SANT/Myb domain
CDDcd001671.19E-7139183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDRKFNGEWS ACDIKIVKSL IASRNANNNY ADDLNKKHND IVNDIQARFP WKERDQVIEL  60
YVELVVEMIS PTQSGNQFVV ATNNSVNDNF GIPVEDPNMD TLYAYMSNKT PESMRMVVEA  120
PQSQAIIPQQ ERQQKGRFWT IEEHRQFLCG LREYGRGKWK DISRDFVTTK TPVQVSSHAQ  180
KYFRRLERTS EKQRYSINDV GLYDAEPWVL NNSSSWEALA FTGDAYNPNF YGTGRQLSTM  240
NNFSQVWPPF LYGADQASSS QATTWAGQQM GATALALEGA GSQMAWTGDQ QGDFLPEQWM  300
DMDKEY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963442.10.0PREDICTED: uncharacterized protein LOC101780786
TrEMBLK3ZF270.0K3ZF27_SETIT; Uncharacterized protein
STRINGSi025176m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-22MYB family protein